Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00184.20
Common NameAMTR_s00184p00044240, LOC18440173
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 225aa    MW: 24213.6 Da    PI: 5.2478
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00184.20genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +C aCk+lrrkC+++Cv+ap fpa++p kfa +h +FGasn++k+l++lp+  r da+ sl+yeAe  +r
                                              7********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlkaelallkeel 101
                                              dP +G + +i++lq  leql+++++++++el
  evm_27.model.AmTr_v1.0_scaffold00184.20  75 DPTKGPLHHIQSLQMGLEQLQEDIKVAQQEL 105
                                              **************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.644105IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-345102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006850389.11e-167PREDICTED: protein LATERAL ORGAN BOUNDARIES
TrEMBLW1PX401e-167W1PX40_AMBTC; Uncharacterized protein
STRINGSolyc11g045530.1.19e-39(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-36ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089